PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G04550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 202aa    MW: 22704.7 Da    PI: 8.0001
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G04550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.21.9e-101281843694
                      EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3  36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      ++ +  + +s++++l+ r k++r +lt+GW++  +a+  +egD+++F++++ ++  lv+
  ONIVA03G04550.1 128 MVSMAGTTQSYQMRLK-RSKDSRAMLTTGWNQLIDAKAFDEGDVCLFHFKEVDD-VLVL 184
                      3334456799999993.4444459************************876433.2444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.12E-7109186No hitNo description
Gene3DG3DSA:2.40.330.108.2E-9109184IPR015300DNA-binding pseudobarrel domain
PfamPF023623.4E-8113186IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-8133184IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.713136190IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEGGQAVLGT AGASAARRCG RLHGCRRARG GTASSEQCSV PTRVAEVSCG QYGPRTFSGF  60
DKYCWYGNDV TLTKSMHLQI AHVAAVNFAE DSTLRVHCQE NPYDQCENVQ FSERYINKYI  120
GSPIDDLMVS MAGTTQSYQM RLKRSKDSRA MLTTGWNQLI DAKAFDEGDV CLFHFKEVDD  180
VLVLKITQLR HFFGMHYNYP KY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1044281e-126AC104428.2 Oryza sativa Japonica Group chromosome 3 clone OJ1123F12, complete sequence.
GenBankAK0708451e-126AK070845.1 Oryza sativa Japonica Group cDNA clone:J023070F17, full insert sequence.
GenBankAP0149591e-126AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-126CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0GH751e-154A0A0E0GH75_ORYNI; Uncharacterized protein
STRINGBGIOSGA011927-PA2e-57(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1902055